Write review paper on :<\/p>\n
– <\/span><\/p>\n – <\/span><\/p>\n – <\/span><\/p>\n Multimer upgrade: allowing multichain <\/span><\/p>\n – <\/span><\/p>\n o \u00a7 <\/span><\/span><\/span>Treatment <\/span><\/p>\n o \u00a7 <\/span><\/span><\/span>Even <\/span><\/p>\n – <\/span><\/p>\n – INSTRUCTION: <\/p>\n <\/p>\n Write a Mini review;<\/p>\n Title<\/p>\n \u2013 describes the mini-review \u2013 provides appropriate background to the topic. This section should set up \u2013 create logical subdivisions for your mini-review to <\/p>\n Conclusions \u2013 state the major conclusions of your review <\/p>\n and citation: needs way more citation and articles than I already provided<\/p>\n <\/p>\n Please use Times New <\/p>\n Web of Science is another excellent database since it allows you Write review paper on : – AlphaFold basic work overview: Analysing long-range protein sequences, increasing dependability, and producing highly computationally predicted protein structures with amino acid sequences to 3D protein structures (Jumper et al., 2021). – Computational functional basics: AlphaFold prevails over previous protein structure prediction methods by using deep neural networks with hundreds […]<\/p>\n","protected":false},"author":2,"featured_media":0,"comment_status":"open","ping_status":"closed","template":"","meta":[],"disciplines":[40],"paper_types":[],"tagged":[],"aioseo_notices":[],"_links":{"self":[{"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/questions\/36176"}],"collection":[{"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/questions"}],"about":[{"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/types\/questions"}],"author":[{"embeddable":true,"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/users\/2"}],"replies":[{"embeddable":true,"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/comments?post=36176"}],"version-history":[{"count":0,"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/questions\/36176\/revisions"}],"wp:attachment":[{"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/media?parent=36176"}],"wp:term":[{"taxonomy":"disciplines","embeddable":true,"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/disciplines?post=36176"},{"taxonomy":"paper_types","embeddable":true,"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/paper_types?post=36176"},{"taxonomy":"tagged","embeddable":true,"href":"https:\/\/www.writemyessays.app\/blog\/wp-json\/wp\/v2\/tagged?post=36176"}],"curies":[{"name":"wp","href":"https:\/\/api.w.org\/{rel}","templated":true}]}}
\n<\/span><\/span><\/span>AlphaFold basic work overview: <\/span><\/b>Analysing
\nlong-range protein sequences, increasing dependability, and producing highly
\ncomputationally predicted protein structures with amino acid sequences to 3D
\nprotein structures (Jumper et al., 2021).<\/span><\/p>\n
\n<\/span><\/span><\/span>Computational functional basics<\/span><\/b>:
\nAlphaFold prevails over previous protein structure prediction methods by using
\ndeep neural networks with hundreds of layers database, dilated convolutions to
\nmodel long-range interactions across entire protein sequences, and advanced
\ncomputational optimizations to handle long sequences<\/span> (Evans
\net al., 2021). <\/span><\/p>\n
\n<\/span><\/span><\/span>Efficiently Improvement in protein
\ndatabase: <\/span><\/b>Present software gives open access to a large range of
\nspecies that contain specific proteins, for example. Enter only the protein
\nsequence to obtain the name of the organism, the sequence match, the e-value,
\nthe gene name, and the protein name For instance, Cyclic kinase 2 for
\nSequence of “MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREIS” (Varadi
\net al., 2022)<\/b><\/span><\/p>\n
\ninteraction and visual of it allowing deep insight of cellular function (Evans
\net al., 2021)<\/b><\/span><\/p>\n
\n<\/span><\/span><\/span>Uses in field:<\/span><\/b><\/p>\n
\n<\/span><\/span><\/span>Disease research<\/span><\/u>:<\/span><\/p>\n
\noptions are expanded by the machine’s ability to anticipate the pathogenicity
\nof many diseases, such as paralysis through the identification of Alsin
\nprotein. For other disorders, research is still under progress<\/span>. (Liu
\net al., 2021)<\/span><\/p>\n
\n<\/span><\/span><\/span>Could be used in Drug research<\/span><\/u>:<\/span><\/p>\n
\nwhile some research limited access to the protein’s structural details (still
\nin process), this approach sped up the process of developing customized drugs
\nthat target particular pathogenic proteins. (Rosie et al., 2022)<\/span><\/p>\n
\n<\/span><\/span><\/span>Upcoming expected upgrades<\/span><\/b>:
\nImprovement in disordered proteins, AI-based drug Design, Proteomics for
\ndiverse organisms expanding organism and structural coverage (Jumper et al.,
\n2021).<\/span><\/p>\n
\n<\/span><\/span><\/span>Challenges such as disordered protein<\/span><\/b>:
\nPhysical constraints that impede disordered proteins from producing regular
\nresults. Currently able to predict multichain interactions and single folds
\n(Liu et al., 2021)<\/span><\/p>\n
<\/span><\/p>\n
\nIntroduction <\/p>\n
\nthe rationale for the review and often concludes with a thesis statement. \u201cIn this review,
\nwe will highlight….\u201d.
\n[other headings as appropriate] <\/p>\n
\nprovide structure. <\/p>\n
\nReferences \u2013 use the referencing style and citation style of the journal, <\/p>\n
\nRoman 12 pt (or Arial 11 pt). There should be no title page, but include a descriptive title at the top of
\nthe page, and your name and student number in the header. You may include figures and tables that
\nsummarize important information or concepts. These should be your figures and tables.
\nReferences should be formatted in the style of the journal, Genomics. There is no limit to the number
\nof references, but you may not use web pages or web-only sources. All references should come from
\nthe primary literature. Use Pubmed for your searches if you do not have another preferred database:
\nhttps:\/\/pubmed.ncbi.nlm.nih.gov\/. <\/p>\n
\nto see who has cited a particular article. <\/p>\n<\/div>\n","protected":false},"excerpt":{"rendered":"