The Advanced AI now in use of Protein structure prediction with AlphaFold protein: The possible breakthrough

Write review paper on :

         
AlphaFold basic work overview: Analysing
long-range protein sequences, increasing dependability, and producing highly
computationally predicted protein structures with amino acid sequences to 3D
protein structures (Jumper et al., 2021).

 

         
Computational functional basics:
AlphaFold prevails over previous protein structure prediction methods by using
deep neural networks with hundreds of layers database, dilated convolutions to
model long-range interactions across entire protein sequences, and advanced
computational optimizations to handle long sequences
(Evans
et al., 2021).

 

         
Efficiently Improvement in protein
database:
Present software gives open access to a large range of
species that contain specific proteins, for example. Enter only the protein
sequence to obtain the name of the organism, the sequence match, the e-value,
the gene name, and the protein name For instance, Cyclic kinase 2 for
Sequence of “MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREIS” (Varadi
et al., 2022)

 

Multimer upgrade: allowing multichain
interaction and visual of it allowing deep insight of cellular function (Evans
et al., 2021)

 

         
Uses in field:

 

o  
Disease research:

§  Treatment
options are expanded by the machine’s ability to anticipate the pathogenicity
of many diseases, such as paralysis through the identification of Alsin
protein. For other disorders, research is still under progress
. (Liu
et al., 2021)

 

o  
Could be used in Drug research:

§  Even
while some research limited access to the protein’s structural details (still
in process), this approach sped up the process of developing customized drugs
that target particular pathogenic proteins. (Rosie et al., 2022)

 

         
Upcoming expected upgrades:
Improvement in disordered proteins, AI-based drug Design, Proteomics for
diverse organisms expanding organism and structural coverage (Jumper et al.,
2021).

 

         
Challenges such as disordered protein:
Physical constraints that impede disordered proteins from producing regular
results. Currently able to predict multichain interactions and single folds
(Liu et al., 2021)


INSTRUCTION: 

Write a Mini review;

  Title

 – describes the mini-review
Introduction 

– provides appropriate background to the topic. This section should set up
the rationale for the review and often concludes with a thesis statement. “In this review,
we will highlight….”.
[other headings as appropriate] 

– create logical subdivisions for your mini-review to
provide structure. 

Conclusions – state the major conclusions of your review
References – use the referencing style and citation style of the journal, 

and citation: needs way more citation and articles than I already provided

Please use Times New
Roman 12 pt (or Arial 11 pt). There should be no title page, but include a descriptive title at the top of
the page, and your name and student number in the header. You may include figures and tables that
summarize important information or concepts. These should be your figures and tables.
References should be formatted in the style of the journal, Genomics. There is no limit to the number
of references, but you may not use web pages or web-only sources. All references should come from
the primary literature. Use Pubmed for your searches if you do not have another preferred database:
https://pubmed.ncbi.nlm.nih.gov/. 

Web of Science is another excellent database since it allows you
to see who has cited a particular article.   

Ace Your Assignments! 🏆 - Hire a Professional Essay Writer Now!

From question to order

Get writing support for your assignment

Enter your email, paper type, length, and deadline below. On the next step, add the topic, instructions, sources, and supporting files. This first step does not take payment, and you can review writer applications before assigning someone.

Start your order

Complete these fields to continue to the full order details.

How our paper writing service works

It's very simple!

  • Fill out the order form

    Complete the order form by providing as much information as possible, and then click the submit button.

  • Choose writer

    Select your preferred writer for the project, or let us assign the best writer for you.

  • Add funds

    Allocate funds to your wallet. You can release these funds to the writer incrementally, after each section is completed and meets your expected quality.

  • Ready

    Download the finished work. Review the paper and request free edits if needed. Optionally, rate the writer and leave a review.